PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14567_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 204aa    MW: 22863.8 Da    PI: 8.841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14567_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.6e-202572148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd +l+++++ +G++ Wkt+a + g++R++k+c++rw++yl
  cra_locus_14567_iso_2_len_901_ver_3 25 KGAWTAEEDRRLAQYIEIHGPKKWKTVAMKAGLNRCGKSCRLRWLNYL 72
                                         79********************************************97 PP

2Myb_DNA-binding50.35.6e-1678123148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_14567_iso_2_len_901_ver_3  78 RGNISIEEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 123
                                          678889****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1662072IPR017930Myb domain
SuperFamilySSF466894.77E-3024119IPR009057Homeodomain-like
SMARTSM007176.1E-162474IPR001005SANT/Myb domain
PfamPF002496.9E-182572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-242679IPR009057Homeodomain-like
CDDcd001671.73E-122772No hitNo description
PROSITE profilePS5129425.73873127IPR017930Myb domain
SMARTSM007172.9E-1477125IPR001005SANT/Myb domain
PfamPF002492.2E-1478123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2580127IPR009057Homeodomain-like
CDDcd001671.50E-1184123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAPIKLSAAA EGCSSNPKRT VTNNKGAWTA EEDRRLAQYI EIHGPKKWKT VAMKAGLNRC  60
GKSCRLRWLN YLRPNIKRGN ISIEEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN  120
SHLSKKVNST KRSDVVSASI QESPPQTTTN STSSAEAEPQ PTQLGHGDDM ADLSFDVNDF  180
FDFSVEGTFG MDWISKFLEL DGNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-302412726128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008364573.16e-87PREDICTED: transcription factor WER-like
SwissprotQ962763e-54MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A061GB739e-86A0A061GB73_THECC; Myb domain protein 5
STRINGVIT_00s0341g00050.t011e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154